SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5476.CAL0003046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5476.CAL0003046
Domain Number 1 Region: 63-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 2e-30
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5476.CAL0003046
Sequence length 156
Comment (Candida albicans)
Sequence
MDYFQTEKTTETRQQRQQKKRPVRNSIICTLSLSYQPNFVMSSLIGWLSSWFQNEPITPE
LKKEIESNINSHKVLVYSKSYCPYCTSTKTLLQSLNQDYKVIELDQIPKGSAIQNGLQEL
TGQRTVPNVFINGKHIGGNSDIQALHSQGKLKPLFG
Download sequence
Identical sequences C4YTR3 G1UAU6 Q5AH29
CA4964 XP_721347.1.88832 CAWT_05558 5476.CAL0003046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]