SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5476.CAL0004253 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5476.CAL0004253
Domain Number 1 Region: 32-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.1e-26
Family Glutathione peroxidase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5476.CAL0004253
Sequence length 176
Comment (Candida albicans)
Sequence
MTDGKFPTNIEPKYIPYSKDHASLTACANPIPLDLKSLFPNNTVVVTAVPGAFTPTCTEQ
HIPDYLKHLKDFKDKGVKKIIVLSANDPFVMAAWAKALGYTDEENYVIFATDPNASISKE
LGDGFVADLTSAGMGLRLQRYASIVVNGEITYLETEDSLGFSEISSAETILKRIHN
Download sequence
Identical sequences C4YHK7 Q5AF44
XP_720512.1.88832 CAWT_03554 CA4127 5476.CAL0004253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]