SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5476.CAL0005458 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5476.CAL0005458
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.3e-64
Family Glutathione peroxidase-like 0.000000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5476.CAL0005458
Sequence length 196
Comment (Candida albicans)
Sequence
MAPVVQQPAPSFKKTAVVDGVFEEVTLEQYKGKWVLLAFIPLAFTFVCPSEIIAYSEAVK
KFAEKDAQVLFASTDSEYTWLAWTNVARKDGGIGKVDFPVLADTNHSLSRDYGVLIEEEG
VALRGIFLIDPKGVLRQITINDLPVGRSVEESLRLLEAFQFTEKYGEVCPANWHPGDETI
KPSPEASKEYFNKVNK
Download sequence
Identical sequences C4YNZ5 P0CU34 Q9Y7F0
CAWT_02929 CAWT_02945 CA5714 5476.CAF0007120 5476.CAL0005458 XP_019330878.1.88832 XP_716082.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]