SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 561229.Dd1591_0205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  561229.Dd1591_0205
Domain Number 1 Region: 105-202
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000157
Family Collagen-binding domain 0.008
Further Details:      
 
Weak hits

Sequence:  561229.Dd1591_0205
Domain Number - Region: 268-315
Classification Level Classification E-value
Superfamily Sialidases 0.00687
Family Sialidases (neuraminidases) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 561229.Dd1591_0205
Sequence length 496
Comment (Dickeya zeae Ech1591)
Sequence
MKLYRTGLFFITAGLTFSLGSAMAETTVPVEVKDTNKLPNKGVVSLFKAPDKIQQKASDK
YQFTKSEKDGVIVITPDVSAPKAAAKNKSLKSLSSSQAATSDSTFTPLCPTLAVNSIYTL
SGLQNGGSACYHFEITQPSKTTTFVTGMSSGTNVSLTLFSDDGKNNLTPIYYSDNPDNSD
EATLNLTKPGHYYWYIEANTADGSELNFGAIVNTNIDSYELNDAPSLATVVPDGLYQIKG
NSDSDVDVDYYTFTAISGQQVLLQLAGADNAANNYWLIAYSTDDGNTWVTSNTGQQNTIT
PSKSNETILVRVSPNPAKLPTPTQYYLLSFGSKIASFTNSVKGESSVLNIPYSAPTPYGS
MTTQAYRTVTWNVRLADSTGAGIPNVDAVLYLDQRAERQGDKVILEFNPSTAHVITTDAS
GNASGTITLDTCYADSTTEFNNYDRGYLNTWSTTFDFGAWRLEVPIQEGIGVGGNNVQYV
TFGHICKQTLVRSVKS
Download sequence
Identical sequences C6CGM9
561229.Dd1591_0205 gi|251787856|ref|YP_003002577.1| WP_012767988.1.79317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]