SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 561231.Pecwa_4317 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  561231.Pecwa_4317
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000131
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 561231.Pecwa_4317
Sequence length 147
Comment (Pectobacterium wasabiae WPP163)
Sequence
MAELISPQKKLTPQEMSDFESIFSVSIPDSFKDHYLKINGGFVSESDVEAELWGLPVNGF
NPIKHGKLTIERLIEDIHEIKPNNGQNGVWGYKQFVPFSYDLGGNIIFISLKYDDWGEVH
LYAPDGGNIINIDSSFTSFLRRLYKMD
Download sequence
Identical sequences D0KCZ6
WP_015731461.1.14155 WP_015731461.1.36680 WP_015731461.1.70306 WP_015731461.1.77019 561231.Pecwa_4317 gi|261823513|ref|YP_003261619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]