SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 565034.BHWA1_00941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  565034.BHWA1_00941
Domain Number 1 Region: 327-415
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000103
Family Collagen-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 565034.BHWA1_00941
Sequence length 558
Comment (Brachyspira hyodysenteriae WA1)
Sequence
MRKIGFVIIINIAMIIIASCSSSQYKLEKKAGGNNTFETAQKINKDGIIGQLEGDNTDYY
YFTFDGKASIIDFYVSNSAYSPVIMTLYDYKNNLIKVINEPDEVQYTEANPITNDIDTNE
TVSSNNNQNKKEDEMIYTTQIMKNIYFEASQNNVDENKYYISIAPKDAVKENIDYMFIIK
KRDYKETDEKEPNDKISAAQIIDVNSDNRLYTIDGYYSQTYNPTLKTGDLKNLETDAYKI
TNSSFNTYSISIELSGVPAIDASIRLYDQKGNWITMKDINNTGDGETVDKLILYPYMSYY
FILASTNAVNNIPYRVSIIAKPYDKYIEHEPNNKPQEAQTIEFNQTYKGAIDYSYDRDYY
NFSIPIKSSVKLSYFLIDSQAINISISNDILGKIITMPQTDDEQEVSLSQGRYYLIFERD
LTKEGWKKGISKARNYEFNMSISNEISGDYNYGYDLYNNTNAYEMDYYNYSNNYLNNNNI
PEEQFEENLESNFNNTNNVIIIRPEDYNSEYYYYSNEEDTNNNENMYNDYYYQDNTYEND
TYYHNDEDNTYEDNGYYE
Download sequence
Identical sequences C0QZZ4
565034.BHWA1_00941 gi|225619879|ref|YP_002721136.1| WP_012670481.1.100804 WP_012670481.1.24165 WP_012670481.1.24451 WP_012670481.1.28499 WP_012670481.1.37874 WP_012670481.1.44798 WP_012670481.1.45318 WP_012670481.1.54887 WP_012670481.1.67878 WP_012670481.1.95541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]