SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5671.LinJ14.0100 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5671.LinJ14.0100
Domain Number 1 Region: 443-549
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000108
Family Calponin-homology domain, CH-domain 0.0077
Further Details:      
 
Weak hits

Sequence:  5671.LinJ14.0100
Domain Number - Region: 326-395
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0262
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5671.LinJ14.0100
Sequence length 1029
Comment (Leishmania infantum)
Sequence
MSASRQASKVSATARATKFSAIRKLPTAKQSTSAVAAAHTSSDEPRRPALISFDVDATID
TVNSLHEEQHRVSEEDVTDKRIGRYHYAQLVARLNEQRSLYQSTAVFVETMLKEVNHSTE
ASVAMKASAATWGLKLLAKHAGYGAISTVLESLLPALYCEYSPEKLCRASPAVELQVRRP
DVLMDNPYFTHSMFVDEVQVDKRSATKLQKSLEAALRANDQRRSIVCHLIERQRQQQLEV
VFRCWRHHVRQQHLLRMMGDNTAKQWADEMSRLRVQAVFYHWKLLVERSRSTYLTERLHE
AAFQLENAKNQFQLQCYRADRLVRTAKEATEEMERVSQINEDLQRQVDELKEEQVRKERE
YKEKLTRNVTQVLKLLETYDALARVLLHSKQADEYFMPEKPLLARHSQSGDGGEEASENE
GQLLEVNAVAEASWESPSGSALQCLRQWCDGVLGQASGRTEPFKPIRSFGADFSNGERYL
YIFQHVFPEVVPTVLQIHDMDVESRLRRIRGYVADCGLRYRLVPSDLMNQREDLLVCSLS
ELYQQHLLRKWDQMVSRSMTELNALREGDMKEALLGCTASSSTEDVADVPAEQLDEAAVR
AHVSDYVERVKAMSEEFRTSLAVENEVVKASTAIAVQEARLGGERLQGTPIPLVDEAERC
AFWKLPAGALDDLRGAKKLNSEERMWNLIVTQTLPEVLQAHVDTTSRLFYLFAGENAKSL
SEVAFWRLVECSGILVGGMEVPMDWIARQYDHVVTPQLDAALRAVARNQSEMSVQKLRQV
AYQEMDIRSATPQQFVELLVRLAMASEKGKYGLVEGTRRLLQGLQLLNNEISPVARALHE
PEAQHVLRFFNEDLFRVYLFYVKKQESSRNTQDASMATQFGGRFASQMSITMLLTMLEDC
RFLLDGSGRRNSSIGVSADFTRPLFFINAAQVRKVVSALGSFCKGAMSGGLSFNLFVDTL
AVLAHHWCPDPLVPEPRRLAGFLAHTVQQLSARHINSTLLLGTVPSIRLEGPRNVDFSQE
ARPSVGTVA
Download sequence
Identical sequences A4HVV2
5671.LinJ14.0100 psu|LinJ14_V3.0100 gi|146081198|ref|XP_001464193.1| XP_001464193.1.40037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]