SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5671.LinJ30.1160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5671.LinJ30.1160
Domain Number 1 Region: 103-401
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-83
Family Protein kinases, catalytic subunit 0.00000207
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000155
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5671.LinJ30.1160
Sequence length 510
Comment (Leishmania infantum)
Sequence
MSGYLKVLSPDGRWETRYVEIDDAKLRIWRTKGDKESSAAVVKELDLKCATLREVSEPNT
WAVQPEKAEATYFQADGEERKTEWMDTLRHYNSSSSASEKVTLRDFEKKFVLGKGSYGKV
FMVVKKDTDKWYAMKEMSAEKMRQAEIKAPFAERIILEEIDHPFIVHLHYSFQEQGNLYM
ILDLLAGGELFTYIEQHAPLDEEVVKFYAAEVALALGYLHSRNIIYRDLKPENVVFDRDG
HACLTDFGLAKANVHEPNAVTYCGTNEYLAPELLKGVPHGKAVDWWSLGLMMCEMLFNDL
PFYDENPMQMQMKILTEDVAFPPHIQITEETKDLIRCLLNKNPERRLQTLEAFKAHKCFS
NLDFGLLEARKLKAPITPDPNPAHNFAKEFTSEVIVQNESPSQAVVTLAGYTYDRDLSEQ
EKSPSHSPTIAEELRQRRASMKKSTNGSDAASPPVTGENRTSNSSPAGAPTKQAAAGPVK
KVEHHIPAKVAPQAARKKLTGNKSFDKPTK
Download sequence
Identical sequences A4I5B1
psu|LinJ30_V3.0850 XP_001466930.1.40037 5671.LinJ30.1160 gi|146093638|ref|XP_001466930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]