SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5671.LinJ33.2610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5671.LinJ33.2610
Domain Number 1 Region: 419-472
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000737
Family Transcriptional factor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 162-242
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000000000157
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.004
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000126
Family PWWP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5671.LinJ33.2610
Sequence length 473
Comment (Leishmania infantum)
Sequence
MATYVPGDRVWVYIEGDGWWPARVLSDEEMGTRTPGFDLAVQFYAGVEQPATLYELNSHA
DAANICFFETSSEKAVTGNPELEASIRCACADAEANPLKSASAIVGGARVAAGGSGAAGS
AGAAAVNRAAVKRVRDMGDDDTGTYGGGAAASRSASGYHHLRSDELHELSSKISSAVAAA
DLTAVRAALCQLDGVDVYLTELEDTKIGVAVGSVLSQPALKPLWPLARAMISFWARHLPA
ETLAAIRSVQQRQLPVPAISAAAAAEPSSPHNKRQQPLPAVPSRSPFASSVSPSAATAAG
GAVGGAAAGACSGDVAPTQRKTFYDNVYQLLDSPLSTTRYDDTVIDEVARKLATEITDRD
ERQMLLLRLREEELSFIRDHLLSGEWTPKKYLDQPNEVFTTKSEKARQEQRIQEKMKAIE
AADNAMLNITSLFKCGRCGKRHCTFYEQQTRSADEPTTKYITCLDCKNTWTQE
Download sequence
Identical sequences A4I9C2
psu|LinJ33_V3.2950 XP_001468341.1.40037 gi|146098158|ref|XP_001468341.1| 5671.LinJ33.2610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]