SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5671.LinJ33.2620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5671.LinJ33.2620
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000421
Family PWWP domain 0.01
Further Details:      
 
Domain Number 2 Region: 318-380
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000327
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0041
Further Details:      
 
Domain Number 3 Region: 549-589
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000366
Family Transcriptional factor domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5671.LinJ33.2620
Sequence length 593
Comment (Leishmania infantum)
Sequence
MSTSTSADYPVNSWVWVKQSGYPWWPAMVLDPAQAGQDPPEGSDVVLLCGPSASATLVFA
SSADAEQLRPYHGAAADAELIEAGRSDESCAAAIEEMIAAVASTDAAPEEEGPQTTPSAS
GAVGEQGHHAFSGEDDVDWEALAAEAEATMAEPQNAVARKKRKEDKKRKKRKRNGSSGGD
RHADGADPRKTRKDKPSKGHRRHRSGDADSANEAEVSSGDDEDDSENDEDMFQRRKGASS
SRSAKKVKYERQSKLEEYDLGPGTLSDYSPRNDPAYYYRKVRSARRTASSTELQTCTQEL
RGFMSRCLSGAATALDVEADILGVLRQLKSVDVTVAQLQETGIGVAIGSLLRFFTPPVVQ
LAQAILNYWFHSLPQNTQQQLSAENEVDRCSIETCSDGVAGDNELGRIGVNLFSCFTNEE
IDDAPASVDAMALCGAIEDALERRCDADAQMLVLSAFGDTGDTGKALRRLLLEGKIYVED
IINHTGNLPLLVRTRQRRPPNMQFTFNPPASQDRSDIDSPTSPYGAFSPNDDGSTGSPTF
GSPAGRTTTALYSCPHCGANDAYQRSYSVQAHDNMPDILRCKKCGQTWNVAEQ
Download sequence
Identical sequences A4I9C3
5671.LinJ33.2620 gi|146098161|ref|XP_001468342.1| psu|LinJ33_V3.2960 XP_001468342.1.40037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]