SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5671.LinJ35.5120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5671.LinJ35.5120
Domain Number 1 Region: 90-369
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-69
Family Protein kinases, catalytic subunit 0.0000351
Further Details:      
 
Domain Number 2 Region: 373-476
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000131
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5671.LinJ35.5120
Sequence length 477
Comment (Leishmania infantum)
Sequence
MPPKEVEHGSASTELLNQYAKYFPHVLFTSDEAFEKHAATLDPEAYKNCVDLPEGEEPPE
SNPREHMYVLTTLVGRNPTTAAFVATRGSDPSEKVVAKFVMLNDDRQATYARSELHCLAA
CKHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQRLKEHLPFQEYEVGLLFYQIVLA
LDEVHSRRMMHRDLKSANIFLMPTGIIKLGDFGFSKQYSDSVSLDVASSFCGTPYYLAPE
LWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGKYDPFPCPVSSSMQA
LLDPLLSKNPNERPTTQQLLHTEFLKYVANLFQDIVRHSETISPSDRTEILRQLQESGER
APLPSSIRYGVMTSQVTHGGYLYKYGSDYRWKKRYFYIGDGQLRISLSENPENDGVAPKS
VNLETVGDVFPVPEVYSQKHPNQLVLWFNNGQKIIAYANTMEDRDMWISKFHRACGM
Download sequence
Identical sequences A4IC37
gi|146102203|ref|XP_001469306.1| psu|LinJ35_V3.5160 XP_001469306.1.40037 5671.LinJ35.5120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]