SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 56780.SYN_02414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  56780.SYN_02414
Domain Number 1 Region: 341-395
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000383
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 56780.SYN_02414
Sequence length 769
Comment (Syntrophus aciditrophicus SB)
Sequence
MKKSDTSHQMPMLSVIPTQIILLWIAFLIMIILPTPIQADMGRVVATEAQVSEDSQKAII
LHNREEEVLILGTDLKADKSARIIRFIPFPEEPKVQLASPASFESAMDLIKKHGLKFIEQ
TKGGRAAARAVEMRFNQRLGSHDVTVIRINDAAEFNGWVREFLRQKGLQLKREDPKIEAV
VRDYTRRGFVWFVFDFVTVNEQIRFVEPIQYRFKTKELYYPLKTSNTFGGSGMIDLILIT
PGTFCEPLQSYYGGCFGFQEMRATTSSQLENDEMKGIFPGIGQFSKNQNMFIQLMRYQGD
YEFDQDLLGDFGQAVPYAIGHVEEAWGSPWLFPMEENVKDLKERCRLKPDSGPCKAIFWR
YFFNPETQKCEKFVYGGCEGTVPFETKEECVALCEKDGGASSTLKNINFEEFTPSSKHFT
LQIPAGWPREEYDIQRSSLLSGNNKYELTVRAPGQEGLEYLSVRVAWHRDACGTPERFIY
DLLNPRFSSRRADAKVLPLTGPEAKTLEIKKVRQPFQGMNAKPVKAIERYVVIPAHTGFY
VLVYDAPEALFKENKWVFDKILSSFQPMVSLNSKPEPVAEVSDDEYEVYADFFSAEEVRG
FEIPPYFSNTYRARHVYHETSAGKNSDKQTLTHLMESFGALDKSIMEDYREKNKRVRILR
DRMVVPWLEILQTNEPNREGGRGMEQPLTVFPDEVFLSRIGFNEQKDTALFYVSQNGAPM
TGYFVLMVKKKNRWVIKNAVLEDFKIPYSEISPSFQYIQHDISDGKGGR
Download sequence
Identical sequences Q2LXC8
56780.SYN_02414 WP_011418758.1.90099 gi|85860708|ref|YP_462910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]