SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5691.Tb11.02.1460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5691.Tb11.02.1460
Domain Number 1 Region: 313-359,410-676
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-27
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 132-201,243-267
Classification Level Classification E-value
Superfamily POZ domain 5.34e-17
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5691.Tb11.02.1460
Sequence length 729
Comment (Trypanosoma brucei)
Sequence
MNDRPHFYEAPDLMDEHGAPIVFDDVYSDLLSVAVEESANDGSRPVCGLEAVRPVDNEIH
SVADEGTESEGRHALDVLLYEYEHIRNAMKRCVRASHEVLRNLQQKRHRIEQQERTVRRR
TELASSSTSFPIFKLNVGGMRFHVQRETFLQFDVTLFHVLCNEQFAVQKDECGYVFFDRD
PWLFRELLFLLRERKQCLVENEVASPLVPPQDQQGDMQHHRHQRRPQELYSVGQRRLAEL
PPIERQRLLEEARYYGLNELVAELLTRQYEWRHCVFGPLPSLDLAHGCDQVQPPLLASPR
EFESQRLEEGGHTPLPPPRCCFASSVFLNGSIYLFGGFGSEGEVIGTLYRFQLKPGSMCE
AGAEIEGNDSGSCREPHGANSDAKGRHTRANACVPGRPFMWYDLVEPHREGRRGVPPPRT
GHAAASWGNCFVLVFYGNNLYHHLRDVWMYHTIQNAWYEVKVCGADVPARSGHTVTVMQG
RFYLFGGKDLFQRDARCFADVYEGLFDAEGMELTWRLASSSGEVQQADRLRQPLAACDEN
CGEPCDAPSAAYHSAVEHKGRYIIVYGGLRDSEGITNGENPGGLRGNMGVGTAPAAYDTN
LRLYVFDTLGGTWQRVQTRCAESKDQMGSDIPLTGHVAVLCHDHMYVMGSYDCTHHQRLE
VFRLSLVTLLWCRVPTSVAVGHIPPCSRALPSIVLLPPTVEAPRSVIMVFGGYNTNTCQY
LNDSYLISL
Download sequence
Identical sequences Q386B8
5691.Tb11.02.1460 Tb11.02.1460 gi|71755121|ref|XP_828475.1| XP_828475.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]