SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2DGG1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2DGG1
Domain Number 1 Region: 7-230
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.4e-73
Family Calponin-homology domain, CH-domain 0.0000555
Further Details:      
 
Domain Number 2 Region: 995-1100
Classification Level Classification E-value
Superfamily EF-hand 3.07e-16
Family Calmodulin-like 0.012
Further Details:      
 
Weak hits

Sequence:  5722.A2DGG1
Domain Number - Region: 253-368
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000547
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2DGG1
Sequence length 1129
Comment (Trichomonas vaginalis)
Sequence
MSNNRGLLDDAWEQTQIKVFSRWTAKQLSFKGIPFDNVLEEFADGVKLIQLLEIVSKEPM
KGKWHKQPKMRVQMRENCGMALDFISSKNIRMVGIGSDDIIDKNKKLTLGLIWTIINKFM
IEEISVEEATARDALLLWAKKNTQGYKGVNVTNFTTSWSDGLAFCALINKFRPNMLDYDS
LDQTQQKENCEKAFAACKELGIYVFLDPEDLVGTQPDEKSVVTQVAEFFHFFAGESKTQA
AADKLKRTIGIQKAIEEEALNYEKQAQECLDVINTEREKLLAQDYDQTVPGVKSKLFNCI
KFGRVVRPVIVDKRGVAMKTWGQLVTKCNSNGRPIPQVKEELLPPNLNLKFEEIEKTASD
RRDELTKILEELQAKLIKAFDEAANAKIAVCDDINNKAINLTGDLYEQRDALNNYLQQAQ
EAAGTVKELQPQFVELVELRLNNRVKRTVIAVDGEFEQLIATIKRLIEGNKAAIFEYENK
KKIEEYNQAAQKYVDEVAQLKQDLEAIAGELREQRAANVDKSEEIIQKRNGVSDIRPMFQ
ELEKQSLHLGIENTPDAVTAMYTACLSQAQDKITQISKQLVDEYNEKAIAIHEKIGDVHK
TADSVSGTTQEKKDGVLKCQSDLTEIKASIQPTLEEPYQYLQSIKYSNAVKYTPNDLTRD
SDITFAFLTTLLNQLEEQLQSESNDARIAAYNELAKKYVDIANEFHQKVSTIDGDRATRR
NAYLSAQLELGNKREGLSQLKPEYEALERDTLHIRVNDSPATISKVYANALQIITDKLAE
IYNEMVADFDAQVLAIAEKVKVVQNVELTGTLLELKDKIAQSKAQAQEILPELPTLDAPW
EDLCDFNLNYRVKQTPENLRATLEAVIAFLNHQEESNNEKLASEGRESRIFAYNQKAAVS
VALARELEQKVSNVDGTLPEKQQKLFDIKQEVIDGDEAAKELTPIFEDLEKDELHLAIED
TPDSIAAFFANILSHIDGLVREIDTAIAAEKGLQISEEQLTEFRETFNHFDKDHTNFLQY
FELRACLTALGDDISDDQAKEVCKKYSATGEEKLNFDEYVKFMLDHFSKAENADTTAKAF
KAIANNNPILTDAQLDQYFKGEEAEYLRKVLKQVDGGYEFAEWVNSIYA
Download sequence
Identical sequences A2DGG1
5722.A2DGG1 gi|121915771|gb|EAY20557.1| gi|154417044|ref|XP_001581543.1| XP_001581543.1.43485 88273.m00344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]