SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2EJ55 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2EJ55
Domain Number 1 Region: 75-305
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.7e-32
Family ROO N-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2EJ55
Sequence length 341
Comment (Trichomonas vaginalis)
Sequence
MKSNQQVYGCIPENLPSYNDAHHANGYFVNNHGYPYAEYEDIGMGTARLFFKFFFGEKDV
TREMPHRNPKSDFNLGNGIRDWWIGHATNLIQIKDKFILTDPIFEKSCSPLKIGNSRKTP
AACKIEELPKISYVLISHSHYDHLNKGSVKKIKSLFPECHFLVPLGVGKILSSWGIKNYT
EFDWRTHLTIEDINFTCFPARHGSARSLSDSNVVLWCSWLIEYENVKIYFTGDTAIGPHF
AEIKETIGRGPDLMIAGIGPTAPSGMMRTVHMDGKDAWNMAKDIGAAKLTPMHYGTFPLG
MKPAKTDLDIFMENAEHGKELVINIGGRIDWNGTEFVKADL
Download sequence
Identical sequences A2EJ55
87823.m00110 gi|121902295|gb|EAY07287.1| gi|123472635|ref|XP_001319510.1| XP_001319510.1.43485 5722.A2EJ55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]