SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2EJP4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2EJP4
Domain Number 1 Region: 264-498
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.83e-66
Family Ankyrin repeat 0.0000939
Further Details:      
 
Domain Number 2 Region: 100-249
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000102
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2EJP4
Sequence length 500
Comment (Trichomonas vaginalis)
Sequence
MSAKDNHPKKYSEFRSIYKYYIDSYNALYQLKTEKEEELNSIYKMIKTNLIDSKEYPPEK
IMNGILHTIPFNNRYAKSYLKLAKLISDDYHVTEIHDIDKMLRYLFYKEYGINLDKSDDF
NNEKYEILDIFEENTICNAIMKNDLKKFISFTESEHFNKDQQINSQLYAYSYVASSLLEI
CCYYGAVDCFKLMRSKFCSEITKGCLILSFLGGNPDIMSECLKHQQPDKDCMEYAIISHN
IDFVSFLMNEYNIEINLNYCGTFNNLDTFLVYLDQTNNVNECFVESPAFDTPSLCEYFLY
IGVDINAQNRELATALHYAALDNKKEIAELLLSHGANINSKDLNGETPLHYATSSDYNET
YELFLSHGANIDEKDTQGQTSLYKAAFYGKKEVVELLLSHGANINEKNKFGQTVLHGGVF
SDNKETIEFILSQDVNVNEKDNCGQTALHLAALNNKIEMAEILISRGANINEKDEVGHTA
LDDALLTNSTEIAEFLKNRV
Download sequence
Identical sequences A2EJP4
XP_001319341.1.43485 gi|121902122|gb|EAY07118.1| gi|123472293|ref|XP_001319341.1| 5722.A2EJP4 92145.m00121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]