SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2F3W8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2F3W8
Domain Number 1 Region: 72-292
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.11e-31
Family ROO N-terminal domain-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5722.A2F3W8
Sequence length 363
Comment (Trichomonas vaginalis)
Sequence
MSALNTIFITNLSTYTTRHHNGKRFINDPGEPMASKSNVNWFSIFKFAFQKDYVDPMPTR
NMTYDFNTKTNATRAWWINHATMLFQLDDKYIITDPIFDDHAAPFPWMIKRTSPTPITME
QLPKIDYILISHDHWDHLNYYSIKTLMGLNPNCTIIAPLGEGQLIRKWGYKVIIMDWRQQ
VKLGDIIITCFPARHMANRYGPLTMGRDLWASFLIEFKNATIYFTGDTAIGPHFKEVRDY
VGRPIDLCPMPIGPQEPNSLMRLVHLDPKQAADMSKILQTRVSFPIHWGTFPLGTKPEIP
DIIVLSQYWNEKQSGKLIVIKNGGYLEYVNGEFKLVDETSLIEQSYFEQQFVEYVQPKLP
EEL
Download sequence
Identical sequences A2F3W8
XP_001313313.1.43485 5722.A2F3W8 gi|121895192|gb|EAY00384.1| gi|123449183|ref|XP_001313313.1| 90013.m00073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]