SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2F4C9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2F4C9
Domain Number 1 Region: 268-568
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-70
Family Ankyrin repeat 0.0000274
Further Details:      
 
Domain Number 2 Region: 177-249
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000131
Family Pseudo ankyrin repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5722.A2F4C9
Sequence length 575
Comment (Trichomonas vaginalis)
Sequence
MTSQEGVLHVYYDLLPLYGDYIDAYDSIYKIKTHDESEILEIFQKIKNVLIGKYKIPVMQ
LLKDIDQASKYRLKYLKSLWALFRMIYDAYHPIEKIDNYVESFPKIINHNIQTGKEISFS
QCLTDGLVDEFLYVYEEGTLLEAVMNDDLDTFKEKVQASKFDVSQTVWHPFEFGLNVLEI
CSYFGSEKVFKYIRSEYNSKISPKCLELSFIDGNSQIVKECMANQKPTNECIYNSCAAHQ
MDFMIYFLNNEDYKIIPRTCAKFRNLQAYLLCIDLNENINKNLEYSPLFHIPHICELLIQ
KGANVNAKGEDGKTPLHYTIEYDNVEFASLLIRNKAEVDAKDNSGYTPLHRCAIYNSTKI
AKVLLENGCKYDEKVKYNEYAPLHLAAEYCHPEIASLLVKAGADVSSVDSCGDTPLHRAA
MSNSFETAKILIENGCSIDAKDFYEYTALHRAAIYNSTKTAEILIECGCNVDAKDSNNCT
PLHKSAEYNQSEIGQLLISRGADINAVNGSDETPLNVAISDAKHGMIQTLIENGADLNLG
NKISEHRLKVVLGHCSLAIQQIFFSNNAAKYQISS
Download sequence
Identical sequences A2F4C9
XP_001313178.1.43485 95836.m00105 gi|121895052|gb|EAY00249.1| gi|123448907|ref|XP_001313178.1| 5722.A2F4C9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]