SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5722.A2FXT4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5722.A2FXT4
Domain Number 1 Region: 141-400
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.36e-92
Family Ankyrin repeat 0.0000335
Further Details:      
 
Domain Number 2 Region: 37-109
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000471
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5722.A2FXT4
Sequence length 418
Comment (Trichomonas vaginalis)
Sequence
MDNDKELLISIIEKSEFDKDQRLDDTFYPYSLKGYSYLELCCYYGSVDCFKFIITKFHPE
ITKKCLRFSFLGGNQEILSECLKKQEPDKKCMKIAIITHNIDFVSFLRNEYDIEIDLADC
GLYNNLQSFLVYLDQTNNIDTCLIYSSYFFLPSLIKYFISHGADINARDKNKRTPLHNAA
YSNSKETAEVLISHGADINARDKNKETPLHKAAYSNSKETAEVLISHGADINARDKYKRT
PLHKAAYSNSKETAEVLISHGADINARDEDEKTPLHNAAYSISKETAEVLISHGADINAR
DEHEKTPLHYAAYSNSKETAEVLISHGADINARDKYKETPLHKAAFSNSKETAEVLISYG
ADINARDEDEETPLHYAAYSNSKETAEVLISHGADVSDNDSDDDNDRDDDNDSYDDSY
Download sequence
Identical sequences A2FXT4
gi|121884587|gb|EAX90295.1| gi|123408578|ref|XP_001303225.1| 5722.A2FXT4 XP_001303225.1.43485 89292.m00038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]