SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 572264.BCA_0591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  572264.BCA_0591
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.41e-31
Family Collagen-binding domain 0.0000832
Further Details:      
 
Domain Number 2 Region: 733-850
Classification Level Classification E-value
Superfamily PKD domain 4.32e-18
Family PKD domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 572264.BCA_0591
Sequence length 965
Comment (Bacillus cereus 03BB102)
Sequence
MNKKSKINKVMLSISTMALSLGALQAPVLAEEKVPYNVLKTKPVGIEKPVDEIGHVSKAE
ETLSFQERLKVGDFSQRPASITNKAAVKQVKESYSMADLNKMNNQELVETLGSIKWHQIT
DLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKGIQTFTEVLRSAFYLAFYNNE
LSELNERSFQDKCLPALKAIAKNPNFKLGTAEQDTVVSAYGKLISNASSDVETVQYASNI
LKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARKEANETMWYGKVDGFINEIN
RIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEYMQQLIDNQDKYNVPEVADDYLAEHA
PKSLTAVEKEITETLPMKDAKMTKHSSQFFNTFTLEGTYTGSVTKGESEDWNAMSKKVNE
ALEQLAQKEWSGYKTVTAYFVNYRVNSSNQFEYDVVFHGIAKDDEENKAPTVHINGPYNG
LVKEGIQFKSDGSKDEDGKIVSYLWDFGDGSTSAEVNPLHVYEREGSYKVALIVKDDKGK
ESKSETTVTVKDGSLTESEPNNRPEEANRIGLNTTIKGSLIGGDHTDVYTFNVASAKNIN
ISVLNEYGIGMTWVLHHESDMQNYAAYGQVNGNHIEANFNAKPGKYYLYVYKYDNGDGTY
ELSVK
Download sequence
Identical sequences A0A158RN80
gi|225862531|ref|YP_002747909.1| WP_001036394.1.2569 WP_001036394.1.44483 572264.BCA_0591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]