SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 572264.BCA_3602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  572264.BCA_3602
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.67e-28
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 3.53e-23
Family PKD domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 572264.BCA_3602
Sequence length 971
Comment (Bacillus cereus 03BB102)
Sequence
MKGYSKKVLVGVSFASLMLGSFQGSALAEGTKGEQASYRNVLKMEPVGLQLPVQELAHSS
KVLENKSFEKRLQFADLSQRPPELKKESKQLATAKIYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNKDSLAFYQNDSRIQAIIDKLKQQGQDYTKDDSKGIETLVEVLRSGFYLGFY
HTELSKLNERSYHDKCLPALKTIANNPNFKLGTLEQNRVVSSYGKLIGNASSDVETITAA
AKIFKQYNDNFSTWVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPKDTVWYQKIDSYIN
ELSRFALIGTVTEKNGWLINNGIYYTGRLGTFHSTGTKGLQVVTDAMKMYPYLGEQYFVA
AEQIATNYGGKDANGNVVNLDQIREDGKKKYLPKTYTFDDGTIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNADDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKIYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGISSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKVHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNRDKYNVPLVSDDYLA
THAPKPVSDIVAEITAEAKLSNVSVKKNKSQFFHTFTLQGTYTGTTAKGEYEDWKSITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNASGQFEYDVVFHGMNTEEGAVNKAPVAVING
PYSGNVNEAISFKSDGSKDEDGKITSYKWEFGDGAVSNEQNPTHVYTKEGTYTARLTVTD
DKGLTNTVTTNVTVQKKEDNSVEKEPNNSFQTANTLQFNQVLRASLGNGDTSDFFEINVE
TAKNLQINVTKENNIGVNWVLYSEADLNNYITYAQQEGNKLVGSYYTYPGKYYLHVYQYG
GGFGNYTVEVK
Download sequence
Identical sequences A0A158RT35
572264.BCA_3602 gi|225865491|ref|YP_002750869.1| WP_000679569.1.2569 WP_000679569.1.44483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]