SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5807.cgd5_410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5807.cgd5_410
Domain Number 1 Region: 107-342
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.96e-61
Family RecA protein-like (ATPase-domain) 0.0000000303
Further Details:      
 
Domain Number 2 Region: 37-92
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000518
Family DNA repair protein Rad51, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5807.cgd5_410
Sequence length 347
Comment (Cryptosporidium parvum)
Sequence
MSTINPNEIVNENNENQNNLNETVYNGPLKLEHLLPSGLTKRDLEILRENGYHTIECLAY
APKKALLSVKGISEQKCDKIKSACKELVAMGFCSGTEYLEARTNLIKFTTGSSQLDRLLQ
GGIETGSITEIFGEFRTGKTQLCHTLAVTCQLPVEHKGGEGKCLWIDTEGTFRPERIVQI
ADRFNLNASDCLDNIAYARGFNTEHQMDLLQSAVAMMTESRFALMIVDSATALYRSEYNG
RGELATRQSHLGQFLRALQKIADTFGVAVVITNQVMSKVDAMAAMFQNDKVPIGGNIIAH
ASQTRLFLKKGRGETRICKIYDSPNLPEGDATFSITEGGINDPKDEK
Download sequence
Identical sequences Q5CS33
gb|cgd5_410 gi|46227223|gb|EAK88173.1| gi|66357650|ref|XP_626003.1| XP_626003.1.25317 5807.cgd5_410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]