SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5833.MAL7P1.159-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5833.MAL7P1.159-1
Domain Number 1 Region: 62-237
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.55e-32
Family Glutathione peroxidase-like 0.000000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5833.MAL7P1.159-1
Sequence length 240
Comment (Plasmodium falciparum)
Sequence
MRMRRTILIFTVILIPLTFCFKNALIKHSINIVSKRGNSKNRFSQKVYESKNIDLENDIK
ENDLIPNVKVMIDVRNMNNISDTDGSPNDFTSIDTHELFNNKKILLISLPGAFTPTCSTK
MIPGYEEEYDYFIKENNFDDIYCITNNDIYVLKSWFKSMDIKKIKYISDGNSSFTESMNM
LVDKSNFFMGMRPWRFVAIVENNILVKMFQEKDKQHNIQTDPYDISTVNNVKEFLKNNQL
Download sequence
Identical sequences A0A024V8F8 A0A024VSZ6 A0A024WA22 A0A024WSV8 A0A024X9Y1 A0A0L1IBX9 Q5MYR6 W7FF87 W7JX88
5833.MAL7P1.159-1 MAL7P1.159 XP_002808799.1.26446 gi|225632188|emb|CAX64072.1| gi|296004905|ref|XP_002808799.1| gi|34591895|gb|AAQ76285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]