SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5833.PF08_0020-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5833.PF08_0020-1
Domain Number 1 Region: 1210-1285
Classification Level Classification E-value
Superfamily RING/U-box 1.68e-22
Family U-box 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5833.PF08_0020-1
Sequence length 1326
Comment (Plasmodium falciparum)
Sequence
MVDKIKEDAIIQNTFQICLKKEECNNNKLYLESYVKELKENNEELYFLLDNLYFILLHKI
SDLHRQKKNCLSYLCSCASRLVDKSLYKGINMNNKESDIIINEISDQIVNSVIIYLENLD
IYPNMKISKKERMEVFYEFLKKSCTSRFLKKLLSFIEENDKNEDDENSKQLNKFFNPIID
LILSNLNNRNLVYPKNDVAVLFSFLTGFKPIADLITHNKSMFLYINVNDRMKDNMNCDIK
KESDKNLLSTCKSMPVNTTDSSTNNITTNRSNNSNGNNDVPQEGPTTTNSNNNNANNNLS
NNNLSSNNLSNNNLSSNSIIRRSVPYAHFHSTIIQNSYSRFSRDKEISTCGYNFQLNSLL
GRLISPTIINMPNILKKEEIAMYKYFFNSNTNSLNKMTLNGLKNTYTLLRKDTDWILENC
VEIIKNLLKSSSDSKKIILLWINCILISNEKKTKIMYHYSTYPQSLDTSYGLFLKLLGEN
SYGFCLNMFWVLLCLCEPITVNKINDLDFFFFLRNDPFSKFLLKNITNQSSFEDKSNVEK
IKKNVERSECFQKEPKFITCIFWMTFKSLSVFFKPAVDEFIKIVQEAGNAKDKDFYYMNI
HAWKIFLYNTRFNQLLFKFLHLCMNYFLHVAYVYDINGNINNSMKTCLNEHNNSLVHLVL
KCCPPPNEKYYNNTKEGTTEGTNIVSHMRENEKVERNEPIGENKRIENNDGVVENNQMNE
SGRNGSLDEDLNRDEREGINISNESNNRVSLGINNNEENTPMVISPLDGSDDRLYASPHF
SIIPTFFLSDIFEILYLLYELDLFKSPNNETLMNYLDIDLFLAFSIFTMLSENHIKSIHL
RCESAPKTFSFLYKLDNLKKVIEESELTKKYIIKSLTNVFIASQKGEYTERMQTRVRIVE
NFNSFFLNKTYVNQFTQLVINNNNLFVHLIHLLLNDVSFLVEEVVSYLSEIKRREENNKK
KKDSQQENEQEANSNSYLNATTRNNRTSNGSSNSVANLNYSSLNNNNNNNNNNNNNNNNN
NNNNSNNFNDSSFNSDNNSDDGEEGGMDYDLSNESMRNLAAKTKMIITYCYKSCIFLNLL
CKNYPNNILTSNTILSQIVTCLNCYFDYLVGPKCLNIKVKNMEQYNFRPQLWLTSIVESY
LFLLNSDKEHEELLIREIANEGRYYKAEIFNKAYYICKREGLLHKEELNKFKNFCQEIVD
MKDEVELFNDVDDIPDNFLDPILQDIMLDPVLLPTSGIIIDRKNIERHLMSEPNDPFNRA
PLSKEQLVPMPQLKEEIQNYINKLRQEKKKKKKKIDNIDFDVENEEFPNFHQEQNGEVQK
NETSNM
Download sequence
Identical sequences A0A0L1I9B8 A0A0L7KDL8 C0H4Y0 W7JV14
PFHG_02779T0 XP_002808880.1.26446 5833.PF08_0020-1 gi|225632279|emb|CAX64158.1| gi|296005090|ref|XP_002808880.1| PF08_0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]