SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5833.PF14_0454-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5833.PF14_0454-1
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.38e-21
Family Calponin-homology domain, CH-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5833.PF14_0454-1
Sequence length 1986
Comment (Plasmodium falciparum)
Sequence
MADETKIGKEELRVWIEDTLKRKDFSFNCLKDGDIYLQLFEYIWPKVMKKYKGRIIMYPS
SDNERKENWKVINIVLKKVQLEEDFIKYNDIVKNNFKPCYESLIILYFLYSLVRYHECDF
ILAHPIDQKLTDFMSSEKPLTCLVKAGSVNLPKNVFENFGNMSQWEDLHVIDDDKGENDD
RGKNDDGGKNDDKEKNDDKEKNYDKGKNDDKEKNYNKGKNDDKEKNDDKEKNDDKEKNDD
IYNEMYNQFNNILSTSHKKLDMQNNVSFKKDDIKKDSSMEHLNLIYPINSHMENTFDKYI
KNCETYTIDHNKEEQQNMMDPIDSNSNIKMEEVSKEYKKKKIFLEMNKENSEELDTRVNR
NYTKEEIKYDKKYDQSDTVVGYEKCVNDDTISYNKHFSDNILSEVTWNRFSSNISCYDDN
KLYNKGLHNNMSNIYNDNMDIKTKNSKEFHINGIKRKSVSHNLSNICTSPCSEFFKYFRL
DDEIFQDNKTKNNVDMINSKEDLLKNDLGLYKKEKYNMCTYKYNSNNNNNNNNKNNNNNN
NNKNNNNNKNNNNNNNNNNDCFGRRPIHFFKHLNKHKVDVPSQTDNNLEDIFLNNIIHHE
NIKNLEIIWNNNEQKLKGESLILFLKNQIKMYKKELSIKNDEIKSIQNIHKKNIDDIISS
HILEISKLKEKHQADIFFIKNQHLENIVSVRKNFESKLNHIEEDLFLDLDILYNEDNGYV
INEQINQIIIGEQNEREKYGTDEHIDNFLNNKEIKKCDMNNNVNNSNDHINNNNNNNNND
DDKINNNNNDDDNINNNNNNDDNINNNNNNNYCYYYNNTLKCSERANNIRDVNYLEIKDN
NNLMIYEKDKIKEHTPNNDILYNNISNEFIRNKDIPFKHEEHNLRNNIIIPHGLDDNPLK
KLKFLWSYKNKEHEDNNKYIKEEMTHLKKIYNQVFLEKTKEYVELYVNNKIFYDILQYIE
KDNNVVKEDILKKNNEHYYGIEEIKKRIYDIILKNNNESNTYMNGKKKEENEIVKELDEN
WLIKLLIYMNSLLQLERLRLEDMKIKQERNNGINNYIKNKNMKKKELIIDEEEELEEDIS
SNEIHRLEKEMDTNEKIKMLKEKNRKLLSLNEFYKKKLEHIQVWKTKLEIMKKNKCNEVI
HNENNMDNKETIFFRKYKCEDDKGVSNKVEYTHNNNNNNYSSDNNNNYSSSNNINYSSDN
NNNNNNYSNNLRNGFTSIWFPLIYLKPVEEENKRDAELMYLLKMLGRYNNENKKNDIWSS
KYEDNDSNTDYTKLINDTYNNDDNIFNFAYDENEYISCIKTENKKSTHKCYNDNENTNYK
NINVEDRKDNFLYAPYNLLNVLKKKLTYIFWQLLGDIYKYRNVIVETCNYIYNIHNLFNE
YINKYEKSEKKNEECYNKYMNDKEDDFLNEKYNLRKIIGVTKLKLEICTNEYMELKENYD
KEKKRLIMLTNTCYENECMKYKNTIQQFKNVDKQLKIYKAREKKWINLVKLLILELKNSS
KTNQEDIKNIWIEIISTKKEIINHNNIYMENNNTNDYFTIHKEDQGKGNNLLNDEKLFIQ
NINRHIDENNFPFEYNHDTSTIYNNNNIVKNNDDLIVKNNKTNKKENRNKKNIQMKEKQN
DKINFYKKDFHSFLDDIVKSELFHFYSYDEPNNFITNKINSHIDMTSININTNEYYRHGD
ELYIDKDNMEDYNLYYNKKINHLYNNYILRNYNNNDNNDKNNNAHSNNIHNNNKHNNNAH
NNNTHNNNAHNNNTHNNNTNNTTKHLSNQIKDKLYEGNDFFSLVSSIAKESCLIFQILLK
IKEDDIKEKTEKITSLEKKLYLLKQYNINEKNKNKLLLAKQEILTNKINTLNIDKHKLQT
HISSINKEKLHLKSHNLTKQQELNLIITYYKNIIISIQKHINKYSTVLLLLDNIPQHDKD
IILNLTNNHDEKCNNLIFSLHKQQKDDLKTKNEFSDQGSHDSSIQQTNLQLLKSKSTNEN
MITGQD
Download sequence
Identical sequences A0A2I0C1L1 Q8IKZ7
5833.PF14_0454-1 gi|124809618|ref|XP_001348628.1| gi|23497525|gb|AAN37067.1| XP_001348628.1.26446 PF14_0454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]