SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5833.PFE1450c-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5833.PFE1450c-1
Domain Number 1 Region: 81-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000626
Family Thioltransferase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5833.PFE1450c-1
Sequence length 183
Comment (Plasmodium falciparum)
Sequence
MFCPFMFLLKIILIILFIKYNVVNGLLKTPCNFSLRNNIISERICNIKLPNLSYKNILFS
RYGRRRRRNMNPFLFIQFKEKKKLPHLLCFHSKDCEYCNSMEKLLTKLKEEEQVHILKLE
MYDNSYNFELLQQLDYNNLCGGLPYYYNLKTHYNICGATTYHNLRNWAIDKKCNPNEPPN
EEF
Download sequence
Identical sequences A0A2I0BUD6 Q8I3H6
XP_001351845.1.26446 gi|124506495|ref|XP_001351845.1| gi|23504871|emb|CAD51652.1| 5833.PFE1450c-1 PFE1450c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]