SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 585395.ECO103_4165 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  585395.ECO103_4165
Domain Number 1 Region: 60-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000968
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 585395.ECO103_4165
Sequence length 163
Comment (Escherichia coli O103 H2 12009)
Sequence
MTKTQINKLIKMMNDLDYPFEAPLKESFIESIIQIEFNSNSTNCLEKLCNEVSILFKNQP
DYLTFLRAMDGFEVNGLRLFSLSIPEPSVKNLFAVNEFYRNNDDFINPDLQERLVIGDDS
ISIFTYDIKSNFFEIRDNIGTENIFSSFSDFSSFLNEIMDSCS
Download sequence
Identical sequences A0A024KR78 C8TY61 C8UHS5
WP_001467618.1.25843 gi|387823510|ref|YP_003000997.2| gi|260846229|ref|YP_003224007.1| gi|387823510|ref|YP_003000997.2| gi|260857551|ref|YP_003231442.1| gi|260870170|ref|YP_003236572.1| 413997.ECB_03294 573235.ECO26_4532 585395.ECO103_4165 585396.ECO111_4253 gi|254163369|ref|YP_003046477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]