SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5855.PVX_099975 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5855.PVX_099975
Domain Number 1 Region: 1795-1836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000186
Family Merozoite surface protein 1 (MSP-1) 0.014
Further Details:      
 
Weak hits

Sequence:  5855.PVX_099975
Domain Number - Region: 1753-1790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family Merozoite surface protein 1 (MSP-1) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5855.PVX_099975
Sequence length 1856
Comment (Plasmodium vivax)
Sequence
MRLAFVLPLPLPVLPLLLPLLLHLCQAFNWKNLHNVHVTTRECALSLIALAEEAERIRLG
KRNDERMAQIVEEMKKERQTLQKLYFSIRHLFSSLGLTFTKELYLFGGDGEKAKQGAKKQ
EDNPSGKRFTDEQHLRGVKTERDLKALLGEMISYYKKEFIQRKAATSCSYINRKNSLRKQ
IEIVRYTHSYVATKLYYREYAKYFQRFLGSGRGMASVLSNPALDIKEGVYSGVYANYGGV
IAGEPKDGPKGKPRDGSTDESQNGPRGRPPTCSDDYKSISGEQCTRQFAQSVKTMLHNFE
TSLQSYIHSSVVEMKKQMIQVEEQQEGENYCRDMEEELKDKSYDKISMAEIERFEQLSKN
YLHKDLDALVQREKKKMYRRRNFFERYFFFIIERMLQVRRGVEAALGALSREPATAPSEP
LTAAKGPLSRGPPIKRTFQLLDEYISMYSFAYEHLKDYHLNVRDLFSLDYIRENSKDNRA
YIAERIAQKMDALNGSFLKYKNVKNRYEQCVEKGIRRSTSMGTLKKGESVSGGGKNVQGR
EFPELWASTWERSSHSFLSEEDKGKKDKLNGELIEREDEYLRRLQNVVKLLSRYKKLKNK
KVKIRHIVNIGKVEMHPILFNLKLRKDQMVGFYRSILHFGKIFVAKRIVLTLKMKLAFLG
RVTPSAFLLSNRFLLLLYETHLGHLQSSYKIGVNKNFCHDLTLENLDGVMKQGDLPHLLL
KYVIYMFGLNSAYMSEHLGGDLGPAVGSSDYIGGSNAANGDANFGEDDPPWGAHNLRVVY
ELARNFTKRPLIHAADFFQSGRTSPNGESNTHDEQVENAFRQMHSYFSSIFNSDEISGHI
LKQFESWEERSSSGCYEGHSCSMEIPVYSKDVIRKSIFYNLHGMGDEFDVLSEATVSSVS
SCATSAYSYVSSAYSYVSSPYPYATSPPLKFPSHLLTNAIITNSLSEAYKYMLYKTQQSQ
AFKLYSRSKGTNITLLETVFLQLILNFGMAPYNKLKGTMVSRFCRKKGRVQEDETSSKTL
VGSFQYGKRKRNFDFIPHIRYVPKGEQLQAGLAISCSEMKQIDGNASHKKTPTKWWNTKR
GSNYSPPNNSTSSHRMHHLGTCELLNGDKQKMTSFEVQHVEYIPNGMAFFAPVVERQNVM
SDYELYGLFFQGARWGEEEQQQEQEQQEQQQQKKRNSPEEGQTEQKRENTKEDIYCSEEK
LAYFFIGESVVYPSEAEDVEEPLIGPILSKSAASQREILFERESMEQYNMILNWLYRSQE
KKNWNREKVRKIEREISVLRGRAKLYEENISHVRGKMAQMRRPPGEGSDLQREYQREVSN
AAREKYNSLMEIYEDTVELFRESERNLTKVKKQNEREGEKVDAEEEEEPGVDYYGLRKYA
LLRKHQVEDLNMYTTYHEQIMKYFQKQNRCCDAYIKEMTIHLQFFPQVCCPREGERQNEE
MLKYIYISITDLVTDFVRCENNTNRLLTHLKKVKDTLHTINTVNANLHKKKRTFHLSTKY
FYREKKEENIYFFTDKVENVKTYKIYRQLIDSVNEDLLFITHIMGKKLEERKEVLQQVEE
KVPTLLDIKRILYADKEVASIHVETLCANFSHENMINYDKVKILGKNFKKKIGMYKNVLK
NIRYSFENEPQVSNDNLALFYNFVEYDSEVDTDAMQFADALLAYNEGGVEVPDRGEDAKN
AGGRPLTMYQEIWRKLNAPKGGGEKRAKERHDDGGDDPGDDQEGDSDRDLYADWDEEDWE
EDSLKAAADRVEKNCRNRKCPLNSFCFIQTINEECLCLLNYSMVGEKCILNEQNSCAVKN
GGCDLKATCELKKNRVNCICPKGTKPMHEGVVCSFSFASTLSQVLLLFAILAFVTA
Download sequence
Identical sequences A5K723
XP_001614841.1.43797 gb|PVX_099975 gi|156097616|ref|XP_001614841.1| 5855.PVX_099975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]