SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5855.PVX_100510 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5855.PVX_100510
Domain Number 1 Region: 10-145
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000298
Family APC10-like 0.046
Further Details:      
 
Domain Number 2 Region: 418-611
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000306
Family Armadillo repeat 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5855.PVX_100510
Sequence length 959
Comment (Plasmodium vivax)
Sequence
MGSKDKDSLKLKYKILSISSNDKDHDVTNLLKNTGGEIYKPWLSEKNCIYPQEIILQIKS
SKIKYLEFLSHEYTISKKIEIFVSNDNKDYLKAGFFRFNDNTSTSYCARELKYVYLPCTI
KCTFIKLKLYSPYSNYLNTHAQVGLYYINIIPEEMPLKIMSEITPAFLKLTSLAYSRNEG
YNDNMVNIKKALLRKKGGNVHRFNITDSNIVDKFSDGETHRGSFKRSYSKGDKNKINCLY
EKLENKIKCFEKLKGECVAKEEYHVASELKKIVNLFIFLKNVITFLKEKKKKYVKEENYG
KAKRLKEKEVKIKIIIKNIEELKIVDDCSRKWYYEWLSLYYKELEFYEKEINKIMSSENI
KIIKKKSGLFDQYNTKNYNGLDLNNVLILICSDDEKKRELGFDLSYKPFEDHGKRNKNFW
HNNIEPLCLIIKRGISDPCYNIFIKSVVTLEKMLIWFQDYFVKVDNIDADKSNSKSAKYI
KCIISALLKRLDDSNLDVVDICIKTIMMMLHNNFISFKCVFSTILSMLFYLFSGDATSEI
NEKIIVSLMSFYYSLINKYYTSVKNDINLKKVLEVISIFLEVDVEPIKQTALDFFVNIYN
RVENKNELFEEFLLNVSFDTKNLIINRVNQDEKEKMKMPMKDSNEKKEIVSETPEKNCMY
VNNDELLNKNYTNNRYLKKQDITPCENNIKRVDEADNIRDNVMESNKREYYSTLVKNTAE
NKQTDGRSKLTTVENSDLKKETCPIEIKELEEKTEDKKNEESEKPQRIDSTPGKETNTDL
IALSGLHKKHSIGELAKHESISKGELNNNIVKKEKAKHEGEYVEDLTKTDENDEADVPAF
TCKYCFKTDESFTEIGLEKHWIKKCPMLCTCPNCFLIVELVVIHDHFLSECSHSYLYETC
EYCNKIVKKNLLDSHVMSECSGKKTEFLSCYYCSLCIESFEIDKWRAHFLSCSKNPRLK
Download sequence
Identical sequences A0A0J9SNW7 A0A0J9TNF7 A0A0J9VSC6 A0A1G4HKR7 A5K8H6
gi|156095629|ref|XP_001613849.1| 5855.PVX_100510 gb|PVX_100510 XP_001613849.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]