SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5874.Q4UG35 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  5874.Q4UG35
Domain Number - Region: 102-146
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000746
Family NusA extra C-terminal domains 0.06
Further Details:      
 
Domain Number - Region: 49-76
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5874.Q4UG35
Sequence length 184
Comment (Theileria annulata)
Sequence
MTATEGLEPEVYQSPLHGNDLVNETLEELRKQRLQANDTTEFDLKPVVDLFTRINEEVAL
HQPKNLVEFVIDFLCKNYPDHLHGFSNIWNSDPELEQSRLVVVEFFKYNRLPVEIASHFT
RAGYDTLDTIASLNRESLVEIEKYSNAEWLPGHKVRLMNMFENIEEYISEFKRERPFQHL
HKSG
Download sequence
Identical sequences Q4UG35
TA19950 gi|84999820|ref|XP_954631.1| XP_954631.1.9581 5874.Q4UG35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]