SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001021260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001021260
Domain Number 1 Region: 49-201
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000667
Family Ricin B-like 0.061
Further Details:      
 
Weak hits

Sequence:  5911.XP_001021260
Domain Number - Region: 204-303
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000356
Family Ricin B-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001021260
Sequence length 311
Comment (Tetrahymena thermophila)
Sequence
MQHQDLIVTIRPAHNPNHYLFPSNDGARGYGADFDVRTHPHQEQRNQLILTHVKDNVFTI
RSATNPTHFVFASNDGVRGFGGDFDVRTHASNEERNQWIIEHHGQGYHIRVYTHPNHYLF
AANDGSNGFGGDFDVRTHPHQEARNLWLIDGLVFAPATQNCTIRVKTNPNHYLFASNDGV
RGLGGDFDVRTHASQEQRNQVLLTRVSRNVYTIACAANPNHFFFPSDDGTRAYGGDFDVR
THPHHEERNKWIIESDNQGGFLIRSLVKPQHYLFAANDGSNGYGGDFDVRTHPHQEARNA
WLIDGFVLSNY
Download sequence
Identical sequences 129.m00110 5911.XP_001021260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]