SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 593117.TGAM_0412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  593117.TGAM_0412
Domain Number 1 Region: 13-42
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000942
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 593117.TGAM_0412
Sequence length 62
Comment (Thermococcus gammatolerans EJ3)
Sequence
MVELKAITFIDRDGELYYRCPRCGMVFRKSRDYIRHVNKAHGWLFRGGRPKGKRALKKLG
KE
Download sequence
Identical sequences C5A3V2
593117.TGAM_0412 WP_015858032.1.60195 gi|240102469|ref|YP_002958778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]