SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 593117.TGAM_1032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  593117.TGAM_1032
Domain Number 1 Region: 182-434
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.89e-58
Family Carboxylesterase 0.01
Further Details:      
 
Domain Number 2 Region: 75-172
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000081
Family Starch-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 593117.TGAM_1032
Sequence length 435
Comment (Thermococcus gammatolerans EJ3)
Sequence
MVKLRNTKALTLFIVILLIASLGCIGGSNGTGASSTTSSEGTSSPPKTTTPMTSSVGSST
SSVETTIWRPPQGEKNVTVTFVVSVPEYTPQNASVYIAGDFNGWNPKDERFRLQKLQDGR
WAINLTFPYGTVINFKFTRGSWESVEVGPSGEEIPSRHFIFRKGGVYELRVYNWHDHVER
VAHTISGNVKVFKMFSSQLNRTVRVWVYLPPDYGKNEKKRYPVLYMLDGQNLFDNATAFA
GEWGVDETLEYLYNKTGFSIIVVGIDNGGERRIDEYAPWVNAEYGRGGLGNATLDFIVEN
LKPYIDALYRTEREETGIMGSSLGGLMAIYAGFRHPDIFKYVGAMSSAFWFNPEIYDFVR
NAPSGPEKIYIYWGTSEGSNPEKIAEDNLKIVEILKEKGYVEGQNLKVVVEEKGEHNELY
WGKHFGEAVTWLFGG
Download sequence
Identical sequences C5A5M2
593117.TGAM_1032 gi|240103089|ref|YP_002959398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]