SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh2_kg.3__1974__AT3G17880.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.fgenesh2_kg.3__1974__AT3G17880.1
Domain Number 1 Region: 220-376
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-32
Family Thioltransferase 0.00042
Further Details:      
 
Domain Number 2 Region: 104-213
Classification Level Classification E-value
Superfamily TPR-like 5.36e-24
Family Tetratricopeptide repeat (TPR) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh2_kg.3__1974__AT3G17880.1
Sequence length 380
Comment (Arabidopsis lyrata)
Sequence
MVDANQVAELRRFIEQLKSNPSILHDPCLIFFKEYLRSLGAQVPKIEQTERDYEERAETK
PSFSPKHADDDDDIMESDVELDNADVVEPDNEPPQPMGDPTAEVTDENRDEAQLEKSKAM
EEISDGKFDEAIEHLTKAVMLNPTSAILYATRATVFLKVKKPNAAIRDANVALQFNPDSA
KGYKSRGMARAMLGQWEDAAADLHVASKLDYDEEIGTMLKKVEPNAKRIEEHRRKYQRLR
KEKELQRAERERRQQQEAQEREAQAALNDGQVISIHSTSELEAKTKAAKKASRLLILYFT
ATWCGPCRYMSPLYSNLATQHPRVVFLKVDIDEANDVAASWNISSVPTFCFIRDGKEVDK
VVGADKGSLEQKIAQHSSSK
Download sequence
Identical sequences D7L7X4
XP_002883093.1.15461 jgi|Araly1|479273|fgenesh2_kg.3__1974__AT3G17880.1 59689.fgenesh2_kg.3__1974__AT3G17880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]