SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59689.scaffold_100261.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.scaffold_100261.1
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.79e-27
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59689.scaffold_100261.1
Sequence length 174
Comment (Arabidopsis lyrata)
Sequence
MTTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRVMGYIMGK
VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK
MYEKLGYIIYRRVLRYYSGEEDGLDMRKALSRDVEKKSVIPLKRPITPDELEYD
Download sequence
Identical sequences A0A087HKM3 A0A178WDM9 D7KCB9 Q8LGI8 R0IDH7
3702.AT1G03150.1-P 59689.scaffold_100261.1 Carubv10010452m|PACid:20891198 jgi|Araly1|887467|scaffold_100261.1 AT1G03150.1 GO.132 AT1G03150.1 NP_563677.1.80155 XP_002889439.1.15461 XP_006303362.1.15642 XP_010474913.1.75697 XP_010474924.1.75697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]