SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000000499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000000499
Domain Number 1 Region: 425-604
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.48e-36
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 2 Region: 611-816
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.19e-30
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 3 Region: 2-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-28
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 4 Region: 222-280
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000658
Family Fibrinogen C-terminal domain-like 0.0033
Further Details:      
 
Domain Number 5 Region: 193-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000000499
Sequence length 950
Comment (Taeniopygia guttata)
Sequence
GNMSFSCLEPQVVPVTFLSSSSFLALQGTSGQDEVFVSFEFRTWNKEGLLLSSKLHQSSG
GFLLYLSDGRIKINLHKTGRVLSDIATGAGLNNGQWHSVSLSVKRSRISVRVDNDVTTSA
HAFIPLQIYSDVFYFGGCPSSGNISECNTSFGGFQGCMQHISIGNKAVDVISIQQNGFGN
FSDLLIDLCGITDRCLPNYCEHGGECSQSWNSFHCNCANTGYKGATCHYPIYEQSCEAYK
HRGNTSGFYNIDSDGSGPLGPFLVYCNMTDATWTIIQHNSTNLTRVKSANRENPHTVFFK
YSASLDQLQATINLADHCEQELAYYCKKSRLLDKSDGMPLSWWIGRTNETHTYWGGSLPA
VQKCACGLQGSCIDSQHYCNCDADRDEWTNYTGFLSYKDHLPVTEIVITDTDRPNSEAAY
KLGPLLCRGDRTFWNSASFNTETSYLHFPTFHGEFSADVSFFFKTIASSGVFLENLGIQD
FIRIELQSPSEVAFSFDVGNGPSEVVVQSHNSLNDNQWHYVKAERNVKEASLQIDQLPQR
SQSAPPDGHIRLQLNSQLFVGGTASRQKGFLGCIRSLRLNGMALDLEERAKITPGVEPGC
PGHCSSYGNLCHNGGKCREKYSGFSCDCTFSAYAGPFFQNKISAYFWTGTSVTYNFQEYY
TLAKNSSSHASSFYADMTLAREAITFAFRTTRTPSLLLYVSSFYKEYLSVILTRNGDLQI
RYKLDSHQDPDVFSISFKSMADGQLQHVKINREEETLFVEVNQNERMKFILSSGTELNAI
KSLTLGKILENSDVDEEIIKANSQGFVGCLSSVQFNHIAPLKAALHHSSSAPVIVKGRFT
ESSCGALTGADSTSSETTHSFADHSGPIDEGKPLANAIRSDSAIIGGVIAVVIFIVLCIT
AIAIRIYKKKGIYSKNEAKGSENEDSAESALKSELSMQNTANENQKEYFF
Download sequence
Identical sequences H0YQE3
ENSTGUP00000000499 ENSTGUP00000000499 59729.ENSTGUP00000000499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]