SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000000574 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000000574
Domain Number 1 Region: 132-192
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000133
Family Ovomucoid domain III-like 0.0011
Further Details:      
 
Domain Number 2 Region: 327-389
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000152
Family Ovomucoid domain III-like 0.0025
Further Details:      
 
Domain Number 3 Region: 68-127
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000291
Family Ovomucoid domain III-like 0.0025
Further Details:      
 
Domain Number 4 Region: 213-258
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000305
Family Ovomucoid domain III-like 0.0019
Further Details:      
 
Domain Number 5 Region: 4-62
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000652
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 6 Region: 263-322
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000111
Family Ovomucoid domain III-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000000574
Sequence length 394
Comment (Taeniopygia guttata)
Sequence
QLDCSQYFSGHTKDGRSWVACPRDLKPVCGTDGKTYSNDCGICLYNAEHSASVEKEHDGE
CDPKPVVVDCSHYRRAVVDDHVLVACPRILKPVCGSDSFTYDNDCGICAYNAEHDSNITK
MHDGPCKESVAVDCTRYRSQATKDGRTLVACPRDLNPVCGTDGTTYDNECAICAHNAEKK
THVGKRHSGRCREKTAELDCKKFPARKVKGGKDLVRCPRILNPVCGTDGFTYDNDCSICA
HNVQHGTDVKKSHDGRCKEESTPVDCSMYLSGTKSGEAIAACPYILREVCGTDGVTYSND
CALCAHNMVYGTQVAKNHDGRCMEEVPQLNCSQYRRTMVKDGRELMACTMIYDPVCGTDG
VTYASECTLCAHNMEHRTNLGKRKNGPCEEDITR
Download sequence
Identical sequences H0YQL7
ENSTGUP00000000574 ENSTGUP00000000574 59729.ENSTGUP00000000574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]