SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000000666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000000666
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-39
Family Eukaryotic proteases 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000000666
Sequence length 144
Comment (Taeniopygia guttata)
Sequence
LALWQLEEEAELNSDVRVLPFQREDRDVAADTVCEVAGWGTTDHSGSRPDRLQQVERPVI
SRDVCNHRTRHDGTITHEMMCTDSRRKDTCKGDSGGPLVCGGVAEGVVTAGSRVCGNYKK
PAIYTRIAPYAAWIDGVMASADGE
Download sequence
Identical sequences H0YQV9
ENSTGUP00000000666 59729.ENSTGUP00000000666 ENSTGUP00000000666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]