SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000000791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000000791
Domain Number 1 Region: 148-296
Classification Level Classification E-value
Superfamily EF-hand 1.29e-48
Family Osteonectin 0.000000349
Further Details:      
 
Domain Number 2 Region: 90-145
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000291
Family Ovomucoid domain III-like 0.0000752
Further Details:      
 
Domain Number 3 Region: 65-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000268
Family Follistatin (FS) module N-terminal domain, FS-N 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000000791
Sequence length 298
Comment (Taeniopygia guttata)
Sequence
MRAWIFFLLCLAGKALAAPQEALPDETEVIEDPTTEEPVGANPVQVEVGEFEEPTEDVEE
IVAENPCQNHHCKHGKVCEVDDNNSPMCVCQDPSSCPATAGVFEKVCGTDNKTYDSSCHF
FATKCTLEGTKKGHKLHLDYIGPCKFIPACLDTELTEFPLRMRDWLKNVLITLYERXXXX
TRPPRPLPWQVKKIHENEKRLEAGDHTVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDG
YLSHTELAPLRAPLIPMEHCTTRFFEACDLDNDKYIALEEWASCFGIKEQDIDKDLVI
Download sequence
Identical sequences H0YR83
59729.ENSTGUP00000000791 ENSTGUP00000000791 ENSTGUP00000000791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]