SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000001774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000001774
Domain Number 1 Region: 228-335
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-30
Family Cadherin 0.00057
Further Details:      
 
Domain Number 2 Region: 435-557
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-28
Family Cadherin 0.00055
Further Details:      
 
Domain Number 3 Region: 336-439
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-24
Family Cadherin 0.0024
Further Details:      
 
Domain Number 4 Region: 119-226
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.0062
Further Details:      
 
Domain Number 5 Region: 548-655
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-18
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 22-97
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000126
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000001774
Sequence length 924
Comment (Taeniopygia guttata)
Sequence
VTTGQVLSLLLLFGVSDWVSAAIRYAIPEEARRGSAVGNVVADLALDLGRLPGRRLRVVS
GGNKKYFGVDLTSGALLVNERIDREELCGALSPCSLSFEIVVENPLELYSGTVEIQDIND
NDPVFPSSQARLEISESVAAGARFPLESAQDPDVGINSLQTYQLSANPNFALDVQTRVDG
SKYAELVLEKELDREEQRELNLVLTALDGGSPPRSAHVQIHIDVVDANDNAPVFNQSTYK
ASVRENTPSGTLVARISAYDLDDGPNGDIVYSFSSHTPAKVRELFALDSATGELRVKGQL
DYEETKLYEIYLQAKDKGAVPGVAHCKVLVEVVDVNDNAPEVTVTSVYSPVPEDAAPGTV
VALLSVTDLDSHDNGLVNCFISPGIPFMLSSSLKNYYTLKTEGALDREKAAEYNITITAK
DSGSPPLSAVKHIQVQVSDVNDNAPRSSQDSYDVYVLENNMPGIPILNVSATDPDLGRNA
HLSYTLLQGDTTFGHLFSINRENGTLYVLTSLDHEDQVEFNMMVQVQDGGFPPLATNVSV
SVFVTDLNDNAPTVLYPQPNTTAAYTDVVAPGTPAGHMVTKVVAVDADAGYNAWISYTLL
QATDPSLFSVGLHNGEIFTARQLREDDAPEHTLVILLKDHGEPVLSTSATISISVAEMVK
EVLTDLTDVAPANDPRRHVTFYLILAVILVSAAFFITMLSVGIFKCYKWRQSRELYNSSR
STTYRTPGPFHHIDAVRGGFTPPSFYHQVYLTTDSRQSDLLCKKPFTSSPLGSRQGTIRN
GEPGLYHQIVGTASRLPTPAEQAQPNTDWRFSQTQRPGTSGSQNGEEAGAWPNNQFDTEM
LQAMILASANEAADGNSTLGGGNGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNA
GKRDAKNAAPAAGNKKKSGKKEKK
Download sequence
Identical sequences H0YU07
59729.ENSTGUP00000001774 ENSTGUP00000001774 ENSTGUP00000001774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]