SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000002813 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000002813
Domain Number 1 Region: 436-654
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000612
Family GUN4-associated domain 0.052
Further Details:      
 
Domain Number 2 Region: 4-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000482
Family APC10-like 0.047
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000002813
Domain Number - Region: 204-265
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0139
Family YmcA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000002813
Sequence length 895
Comment (Taeniopygia guttata)
Sequence
MPHKIGFTVVSSSGHEDGFSARELMVHAPTVNGWRSPRLCQYPQEITLQLVERCRVRKLQ
LLAHQYMIASKIEFYISESLPEYFAPYQSERFQRLGYVPLSDNEKTDFRARELKSVYMDA
VGQYLKLIFHRNYVNKYNLYGQVSLVAVNIIGDPADYDIDSMSSPSREKLIDHYLGIKLD
DPALDGTYLGKCDSISPLDDLAFDMYQDPEVAQIIRRLDEKKREAVRLECYDHAKKLKQA
IADLQKVGERLGRYEVEKRYAVEKEDYDLAKKKKEQMDEYRLKVYQQLELHDLLDAQLLI
RKPPELALESVSGTESPQSSRPEPADPPQGEPPRAEPVLEEQLVDPTSSESVVPYQSPLS
PRIQPTTSKEAFPRENVEILPYDERPLPAVCKQVDEAVAYVESEVTEEDVGDTPRTGNTG
EPEQLTEKALKEASPVVEVFGETLVSGAYSRMWSHREDALLTVYKKLMEVSVDAPKEDLR
NMLRAAVFLVRKAIKDTVSSVFQASLKLLKMIIIQYIPKHKLGKQETSHCLETTLPHLLS
RTGDSSSRLRLLASTFIQEMALCPEVKPLQIIPVHLVKTLKPNATTHLVMSHVELVESLL
GAMGTENSGFTVNNVMKFAMGALEHRAHEVREVVLRIIFDMYREHRAAVLEFLPLDDAGA
RRTVRYKTLVEGFAKIDGKSETEVRALKKAATEAEKQTKEKKKVLKGHQAALKLQLKAEE
KESDFEKTQNQGYKVYEAAAVKIQKELSSTANYLDNLCIFCGEKNEAFTEEGLDLHYWKH
CPVLTRCEHCKQMLEICSLTEHLLCDCDKRDTFGRCPRCREAVPKDELPRHMKSRLCNPA
KPENVANHCPLCHENFPPGEEAWRFHLMNGDGCKMNQRRMFPLNKTILLQSGKAS
Download sequence
Identical sequences H0YWY8
59729.ENSTGUP00000002813 ENSTGUP00000002813 ENSTGUP00000002813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]