SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000003006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  59729.ENSTGUP00000003006
Domain Number - Region: 59-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0702
Family Ubiquitin-related 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000003006
Sequence length 348
Comment (Taeniopygia guttata)
Sequence
LTADGGALPMSHNDSRSFFNLSQLVLSAGQIKPSPALKHSKVTYFEVEIVDVQSKKQICI
VDKVPPASTVLDVKHKFHKACPQWYPSRVGLQLERNGPFLKDSISIQSLAVSSIITLYFT
DLGQQVGWTTFFLTEYTGPLLIYLLFYIRLSTIYDQVESRKNFRHPVVHLACFCHCLHYI
RHLLETLFVHKFSEGHTPLKNMIKGCAFYWGFTSWIAYYVNHPRYTPPSFGHKQVSYAAL
AFLMCEAGNHFINVALAHQTNEGNRTCFPSPTYNPFTWLFLLVSCPNYTYEAGSWISFTV
MTQTLPVGIFAFLMVIQMSLWAQKKHKLYLKRFYPEVRRKAAMIPIIF
Download sequence
Identical sequences H0YXI0
59729.ENSTGUP00000003006 ENSTGUP00000003006 ENSTGUP00000003006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]