SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000003246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000003246
Domain Number 1 Region: 6-64
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000104
Family Chromo domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000003246
Sequence length 528
Comment (Taeniopygia guttata)
Sequence
LYLLAVGEILFALESIEMKWIGKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNS
QYSRIILGLPTINAQPLTLVSALQLPSFARRSNILTGLQDPAVDTRPKLDLGSSGKSQQH
QYELNSKKHHQYQPNGKESSMKHQSHSKGKYYYQLNSKKHHHYQPDPKMYEPHYQPSSKE
PQGQACLDNNKAPLVAHPDKWAHGPAKNLLGPVKSITAESKNGAEKNLSSGTGPPPRDRV
TSNGLGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIKSGEPPRKRAAEERTPKKGGEE
KVEAWRKPGEDRVVGSNALSKAEGESRQPPAELEEGPQKTPLAKELPLPPAEQPLQLTTK
PDLVPWSLSPVCEHSPSSMGLNLSSGSSRKRCLSEPHAEREPGKKRLTSRSISAPTCLSP
PGPERPEPPTQPEVILLDSDLDEPIDLRCVKPRAEGELALAQVKPELPPPPPAEKPAPEP
PQPQEAAEEEEEEEAESLQEFKPFFGNIIITDVTANCLTVTFKEYVTV
Download sequence
Identical sequences H0YY69
59729.ENSTGUP00000003246 ENSTGUP00000003246 ENSTGUP00000003246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]