SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000003693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000003693
Domain Number 1 Region: 199-375,410-573
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-75
Family YicI catalytic domain-like 0.0000978
Further Details:      
 
Domain Number 2 Region: 10-198
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.79e-36
Family YicI N-terminal domain-like 0.0067
Further Details:      
 
Domain Number 3 Region: 576-656
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.62e-17
Family Putative glucosidase YicI, domain 3 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000003693
Sequence length 723
Comment (Taeniopygia guttata)
Sequence
LNKRQALSLFGNDISPIVLEVEFQTKDRLRFRLYDPNKQRFEVPLKIDGPGVTAEEANYE
VEFSDDSSRFRIKRKSTGTVLWDSPLVDLFFSNQFLEITTTVPSTSVYGFGEHEHPTFKH
NMDFVTYGMYARDQPPTSFANLYGVHPFYMCVEPDSNAHGVLLLNANAQDVTLSPNPSLT
FRTIGGILDFYLFMGPTPENVVQQYTEAIGRPHMPAYWSLGFQLSRWGYNSLDVLKATVD
RMKHYDIPYDVQHYDIDYMERRLDFTYDKVNFAGLPEFMKELKKNGKHNVVILDPFVTKD
EEPGTYRPYELGQEMGVWVNNSDGVTPALGQIWPPGYSVFPDFTNPRTVEWWTTLCLEFK
DVLDYDGIWIDMNEPANFMRGQLPGCADTEINNPPYTPSITDRSLAEKTLCPDSKTYLGD
HYNTHSLFGWSQTEPTFNVVQQATGKRAFVLARSTFVGSGKHGGHWLGDNFSLWKDLHHS
IIGILEFNLFGIPYVGADICGFNYNTTYELCLRWMQLGSFYPFSRNHNSIENIEQDPAVF
GDTFAEISRDTLRIRYSLLPYLYTLFYESHVYGGTVARSLMHEFTSDQETHGIDTAFLWG
PAFMIAPVLEEATRSVSVYFPEAQWFDYYTVLPSAWKKTYTTVSAPLNKIPLYIRGGYIL
PQQAPATTTTESRLNPFGLIIALDEEGQASGSLFWDDGDSIDTIEKENYFLAKYTFSNVS
GNI
Download sequence
Identical sequences H0YZF9
59729.ENSTGUP00000003693 ENSTGUP00000003693 ENSTGUP00000003693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]