SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000004124 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000004124
Domain Number 1 Region: 725-1077
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.13e-54
Family Ankyrin repeat 0.0000444
Further Details:      
 
Domain Number 2 Region: 442-745
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-49
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 220-408,439-520
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.19e-46
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 48-156
Classification Level Classification E-value
Superfamily POZ domain 1.61e-21
Family BTB/POZ domain 0.0075
Further Details:      
 
Domain Number 5 Region: 1102-1161
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.4e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000004124
Sequence length 1167
Comment (Taeniopygia guttata)
Sequence
LAEEVAKLEKHLMLLRQEYVKLQKKLVDTERRCNLLAVEANQNNASDTFISRLLAIVAEL
YQQEQYSDLKIKVGDKHICAHKFVLAARSDTWSLANLASTEELDLSDADPEVTMAMLRWI
YTDELELREDDIFLTELMKLANKFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELSAST
LLNYCAEIIASHWDDLRKEDFSSMSAQLLYKMFKSKTEYPLHKAIKVEREDVVFLYLIEM
DSQLPGKLNELDHNGDLALDLALAQRLESIATTLVNYKADVDRADKRGWSLLHKAIQRGD
KFAANFLIKNGARVNAATLGEQETPLHLVASYSPKKHSPDVMAEMAQIAQSLLQAGANPN
MQDSKGRTPLHVSIVVRNEPVFSQLLQCKQLDLELKDHEGSTALWLAVQYITVSSDQSVN
PFEDAPVVNGTSFDENSFAARLIQRGSNTDAPDTVTGNCLLQRAAGAGNEAASLFLATHG
AKVNHQNKWGETPLHTACRHGLANLTAELLQQGANPNIQTAEAVLGQKDAPAPPSAENVH
LQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGMH
TIAAQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGQTALQLA
IQNQLPLVVDAICTRGADMSVPDEKGNPPLWLALENNLEDIASTLVRHGCDATCWGSGPS
GCSQTLLHRAIDENSEQIACFLIRSGCDVNSPRKPGPNGEGEEEAHDGQTPLHLAACWGL
EEVIQCLLEFGANVNAQDAEGRTPIHVAISNQHSVIIQLMISHPDIKLNVRDRQGMTPFA
CAMTYKNNKAAEAILKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSRVQ
DASKLTPLHLAVQAGSEIIVRNLLLAGAQVNELTKHRQTALHLAAQQDLPTICSVLLENG
VDFAAVDENGNNALHLAVMHGRLNNIRVLLTECNVDAEAFNIRGQSPMHILGQYGKDNAA
AICDLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRAGARLGVNNNQGVNIFN
YQVATKQLLFRLLDMLTKEPPWCDGSNCYECAAKFGVTTRKHHCRHCGRLLCHKCSTKEI
PIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences H0Z0N7
ENSTGUP00000004124 ENSTGUP00000004124 59729.ENSTGUP00000004124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]