SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000004372 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000004372
Domain Number 1 Region: 61-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-21
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 2 Region: 241-304
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.88e-18
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 3 Region: 183-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000526
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 4 Region: 1-71
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000249
Family Complement control module/SCR domain 0.00042
Further Details:      
 
Domain Number 5 Region: 118-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000931
Family Complement control module/SCR domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000004372
Sequence length 305
Comment (Taeniopygia guttata)
Sequence
CPRPPEVMFATLSVDKKVYEVGEEVEYTCRPGFMPNSGQRKYTCLPTGKWAFNTLLCLPK
RCPPPPPLQNGKMDFEEFQYQSTVTFSCDPGYNLVGSRTSQCMADGKWTGTVPQCQPVTC
APPSLPEFGVLSFRRLNPGNVSHFLDTIQFECVPPLALIGNETATCTANGTWSSIPVCKV
VTCPTPIGIENGFIEFAVRRTYHYNESVSFGCQPGFVMEGSKHSRCENTGNWSTKPACRA
PCKIPVKKAVVLYNGEKKRVQNDLKDGILHGETVSFFCKNKEKSCAYTVDAACVDGNFTL
PACFK
Download sequence
Identical sequences H0Z1D4
ENSTGUP00000004372 ENSTGUP00000004372 59729.ENSTGUP00000004372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]