SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000005205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000005205
Domain Number 1 Region: 14-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.89e-33
Family PB1 domain 0.0000709
Further Details:      
 
Domain Number 2 Region: 120-239
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-23
Family PDZ domain 0.00000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000005205
Sequence length 291
Comment (Taeniopygia guttata)
Sequence
PLPPLPPLPRPPLQFDAEFRRFAMKRSGAGSFQDFYQLLQTVHQIPRVDVLLGYTDIHGD
LLPINNDDNYHKALSSANPLLRVIIQKKAESDASVFASNSLQRKKKGLLRPAHYRAKPHL
LIGMPQDFRQISSIIDVDILPETHRRVRLHKHGSDKPLGFYIRDGVSVRVAPQGVEKVPG
IFISRLVKGGLAESTGLLAVSDEILEVNGIDVAGKSLDQVTDMMVANSHNLIITVKPANQ
RNNVIRSSKASGSSGVSTDSTPSQQTPSPASQYLSNYSTAESDEEGDLVIE
Download sequence
Identical sequences H0Z3R1
59729.ENSTGUP00000005205 ENSTGUP00000005205 ENSTGUP00000005205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]