SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000006190 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000006190
Domain Number 1 Region: 137-257
Classification Level Classification E-value
Superfamily EF-hand 1.77e-35
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 226-318
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-28
Family Thyroglobulin type-1 domain 0.00076
Further Details:      
 
Domain Number 3 Region: 71-120
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000222
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Weak hits

Sequence:  59729.ENSTGUP00000006190
Domain Number - Region: 326-371
Classification Level Classification E-value
Superfamily ARM repeat 0.00978
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000006190
Sequence length 374
Comment (Taeniopygia guttata)
Sequence
LQDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCVAQDPQTAVCISHRRLTHSMKEA
GLGHKQWRGGPISSNCKQCPVVYTNPVCGSDGHTYSSQCKLDYQACVSGKQISVKCEGRC
PCPSDKSTNAGRNDRRVCSDLEFREVANRLRDWFKALHESGIQNKKTRIVQRPERSRFDT
SILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKNEPCTRAFFNSCDTYKDSLISNN
EWCYCFQRQQDPPCQTELSNIQKQQGGKKLLGQYIPFCDEDGYYKPSQCHGSLGQCWCVD
RYGNEVSGSRTNGAAECAIDLETSGDFASGDFHEWTDDEDDEDEIMNDEDEIEDDDDEDE
GDDDDDDDDHDGYI
Download sequence
Identical sequences H0Z6J2
ENSTGUP00000006190 ENSTGUP00000006190 59729.ENSTGUP00000006190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]