SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000006576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000006576
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-49
Family Calponin-homology domain, CH-domain 0.000000193
Further Details:      
 
Domain Number 2 Region: 192-250
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.03e-20
Family EB1 dimerisation domain-like 0.0000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000006576
Sequence length 264
Comment (Taeniopygia guttata)
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLTLTKIEQLCSGAAYCQFMDMLFPGSVTLKK
KVKFQAKLEHEYIQNFKVLQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANY
DGKEYDPVAARQGQDTIAPNLVTPVVNKTRKSLGTGSAAPQRPIVAQRTPAGPKAGPGMG
KKSGGDDESAGLIEQINVLKITVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVE
ILYATDEGFVIPDEGAPQEEQEEY
Download sequence
Identical sequences H0Z7M6
ENSTGUP00000006576 ENSTGUP00000006576 59729.ENSTGUP00000006576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]