SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59729.ENSTGUP00000006578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59729.ENSTGUP00000006578
Domain Number 1 Region: 143-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000962
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 177-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59729.ENSTGUP00000006578
Sequence length 222
Comment (Taeniopygia guttata)
Sequence
PPVMLVELLFQAACVSLFLSSGQGRVYPTRKKPASFAVERRRVGPHVCFLGSGSGCCPGW
MLSPGSGKCTLPLCSFGCGGGSCIAPNLCMCPDGEQGITCPEPPGTCGEYGCDLSCNHGG
CQEVARVCPVGFSMAETANGVRCTDIDECQSAACEGTCVNTEGGFACECGAGRELSADRR
SCRDTDECQATPCQHRCENSVGSYRCSCRPGYHLHGNRHSCV
Download sequence
Identical sequences H0Z7M8
ENSTGUP00000006578 ENSTGUP00000006578 59729.ENSTGUP00000006578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]